PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004488806.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family LBD
Protein Properties Length: 143aa    MW: 15930.2 Da    PI: 8.4931
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004488806.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260144.53.1e-45131121100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca dCv+apyfpa++p+kf  vhk+FGasnv k+l++lpe++r+da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+++la
  XP_004488806.1  13 PCAACKLLRRRCAIDCVFAPYFPADEPQKFGSVHKVFGASNVNKMLQELPEHQRSDAVSSMVYEANARVRDPVYGCVGAISSLQQQVDMLQTQLA 107
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_004488806.1 108 QAQAE 112
                     99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.80412113IPR004883Lateral organ boundaries, LOB
PfamPF031952.2E-4413110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MKVGGRKQGT MTPCAACKLL RRRCAIDCVF APYFPADEPQ KFGSVHKVFG ASNVNKMLQE  60
LPEHQRSDAV SSMVYEANAR VRDPVYGCVG AISSLQQQVD MLQTQLAQAQ AEVIHIKMHQ  120
FSSTSSDQQH QPSLNMPQSL WSY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0521611e-136BT052161.1 Medicago truncatula clone MTYF9_FA_FB_FC1G-F-14 unknown mRNA.
GenBankBT1446061e-136BT144606.1 Medicago truncatula clone JCVI-FLMt-10M6 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004488806.11e-105PREDICTED: LOB domain-containing protein 4
SwissprotQ9SHE91e-64LBD4_ARATH; LOB domain-containing protein 4
TrEMBLB7FJ942e-83B7FJ94_MEDTR; Uncharacterized protein
STRINGGLYMA08G17990.11e-80(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133434105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.19e-66LOB domain-containing protein 4